Invitrogen™ Human WDR23 (aa 207-347) Control Fragment Recombinant Protein

Product Code. 30202563

Brand: Invitrogen™ RP104546

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82104 (PA5-82104. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WDR23 contains 7 WD repeats. The function of WDR23 remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Specifications

• Accession Number: Q8TEB1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80344
• Name: Human WDR23 (aa 207-347) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0710008A13Rik; C76035; D14Ucla1; Dacf11; DCAF11; DDB1 and CUL4 associated factor 11; DDB1- and CUL4-associated factor 11; DKFZp779A1629; GL014; GLO14; PRO2389; WD repeat domain 23; WD repeat domain 23 isoform 1; WD repeat-containing protein 23; WDR23; WDR23 protein
• Common Name: WDR23
• Gene Symbol: Dcaf11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKFKSIKARDVGWSVLDVAFTPDGNHFLYSSWSDYIHICNIYGEGDTHTALDLRPDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTMREDDPKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining