Invitrogen™ Human WDR19 (aa 688-773) Control Fragment Recombinant Protein

Product Code. 30196192

Brand: Invitrogen™ RP105116

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84395 (PA5-84395. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains six WD repeats, a clathrin heavy-chain repeat, and three transmembrane domains. This gene is conserved from C. elegans to human. It may participate in androgen-regulated signaling mechanisms or in the vesicular trafficking of androgen-regulated secretory processes. Alternatively spliced transcript variants encoding distinct isoforms have been reported but the full-length nature of one of these variants has not been defined.

Specifications

• Accession Number: Q8NEZ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57728
• Name: Human WDR19 (aa 688-773) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATD5; C330027H04Rik; CED4; D330023L08Rik; DYF2; DYF-2; Ift144; Intraflagellar transport 144 homolog; Kiaa1638; mKIAA1638; NPHP13; ORF26; Oseg6; PWDMP; RGD1306997; SRTD5; WD repeat domain 19; WD repeat membrane protein PWDMP; WD repeat-containing protein 19; WDR19
• Common Name: WDR19
• Gene Symbol: WDR19
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HMEVEFAIRVYRRIGNVGIVMSLEQIKGIEDYNLLAGHLAMFTNDYNLAQDLYLASSCPIAALEMRRDLQHWDSALQLAKHLAPDQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining