Invitrogen™ Human WDR16 (aa 220-313) Control Fragment Recombinant Protein

Product Code. 30205561

Brand: Invitrogen™ RP93364

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54731 (PA5-54731. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WD repeat-containing proteins, such as WDR16, play crucial roles in a wide range of physiologic functions, including signal transduction, RNA processing, remodeling the cytoskeleton, regulation of vesicular traffic, and cell division (Silva et al., 2005 ).

Specifications

• Accession Number: Q8N1V2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 146845
• Name: Human WDR16 (aa 220-313) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700019F09Rik; 4933417B11Rik; CFAP52; cilia and flagella associated protein 52; cilia- and flagella-associated protein 52; ubiquitin specific peptidase 43; ubiquitin specific protease 43; Usp43; WD repeat domain 16; WD repeat-containing protein 16; WD40-repear protein upregulated in HCC; WD40-repeat protein upregulated in HCC; WD40-repeat protein up-regulated in HCC; WDR16; WDRPUH
• Common Name: WDR16
• Gene Symbol: CFAP52
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLLVFCKSPGYKPIKKIQLQGGITSITLRGEGHQFLVGTEESH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining