Invitrogen™ Human WDR12 (aa 1-83) Control Fragment Recombinant Protein

Product Code. 30206966

Brand: Invitrogen™ RP96107

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57635 (PA5-57635. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein is highly similar to the mouse WD repeat domain 12 protein at the amino acid level. The protein encoded by this gene is a component of a nucleolar protein complex that affects maturation of the large ribosomal subunit.

Specifications

• Accession Number: Q9GZL7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55759
• Name: Human WDR12 (aa 1-83) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933402C23Rik; fb24f09; HAMAP-Rule:MF_03029}; MNCb-5414; nuclear protein Ytm1; ribosome biogenesis protein wdr12; ribosome biogenesis protein WDR12 {ECO:0000255; WD repeat domain 12; WD repeat domain 12 protein; WD repeat-containing protein 12; WD repeat-containing protein 12 {ECO:0000255; WDR12; wdr12 protein; wu:fb24f09; YTM1; Ytm1p; zgc:55609
• Common Name: WDR12
• Gene Symbol: WDR12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAQLQTRFYTDNKKYAVDDVPFSIPAASEIADLSNIINKLLKDKNEFHKHVEFDFLIKGQFLRMPLDKHMEMENISSEEVVEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining