Invitrogen™ Human WBSCR22 (aa 15-90) Control Fragment Recombinant Protein

Product Code. 30194203

Brand: Invitrogen™ RP92623

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62566 (PA5-62566. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: O43709
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 114049
• Name: Human WBSCR22 (aa 15-90) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110003N24Rik; Bud site selection protein 23 homolog; BUD23; HASJ4442; HUSSY-03; HUSSY-3; MERM1; Metastasis-related methyltransferase 1; PP3381; Probable 18 S rRNA (guanine-N(7))-methyltransferase; ribosome biogenesis methyltransferase WBSCR22; rRNA methyltransferase and ribosome maturation factor; WBMT; WBSCR22; Williams Beuren syndrome chromosome region 22; Williams-Beuren candidate region putative methyltransferase; Williams-Beuren syndrome chromosomal region 22 protein; Williams-Beuren syndrome chromosomal region 22 protein homolog; Williams-Beuren syndrome chromosome region 22
• Common Name: WBSCR22
• Gene Symbol: BUD23
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining