Invitrogen™ Human WBP4 (aa 227-302) Control Fragment Recombinant Protein

Product Code. 30213111

Brand: Invitrogen™ RP106884

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66198 (PA5-66198. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron bridging of U1 and U2 snRNPs in the spliceosomal complex A.

Specifications

• Accession Number: O75554
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11193
• Name: Human WBP4 (aa 227-302) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW545037; BB101031; domain-containing binding protein 4; FBP21; Fnbp21; formin binding protein 21; formin-binding protein 21; hypothetical protein LOC553723; MGC117310; Wbp4; WBP-4; WW domain binding protein 4; WW domain binding protein 4 (formin binding protein 21); WW domain-binding protein 4; WW domain-binding protein 4-like protein; WW domain-containing binding protein 4; WW domain-containing-binding protein 4; zgc:112384; zgc:112384 protein
• Common Name: WBP4
• Gene Symbol: WBP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining