missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197148

Invitrogen™ Human VTA1 (aa 158-227) Control Fragment Recombinant Protein

Product Code. 30197148
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197148

Brand: Invitrogen™ RP104622

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83170 (PA5-83170. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NP79
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51534
Name Human VTA1 (aa 158-227) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110001D18Rik; 1110059P08Rik; AU040813; C6orf55; C85340; chromosome 6 open reading frame 55; dopamine-responsive gene 1 protein; DRG1; DRG-1; homolog of mouse SKD1-binding protein 1; HSPC228; LIP5; lysosomal trafficking regulator interacting protein-5; LYST-interacting protein 5; My012; RGD1305031; SBP1; similar to 1110059P08Rik protein; SKD1 binding protein 1; SKD1-binding protein 1; Vacuolar protein sorting-associated protein VTA1 homolog; vesicle (multivesicular body) trafficking 1; vesicle trafficking 1; Vps20-associated 1 homolog; Vps20-associated 1 homolog (S. cerevisiae); Vta1; wu:fb08c11; zgc:64104
Common Name VTA1
Gene Symbol VTA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.