Invitrogen™ Human VSTM2A (aa 176-242) Control Fragment Recombinant Protein

Product Code. 30203172

Brand: Invitrogen™ RP92866

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54398 (PA5-54398. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in the regulation of the early stage of white and brown preadipocyte cell differentiation. Promotes adipogenic commitment of preadipocytes by increasing gene expression of the transcription factor PPARG in a BMP4-dependent signaling pathway.

Specifications

• Accession Number: Q8TAG5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 222008
• Name: Human VSTM2A (aa 176-242) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: hypothetical protein MGC33530; V-set and transmembrane domain containing 2; V-set and transmembrane domain containing 2 A; V-set and transmembrane domain-containing protein 2 A; Vstm2; VSTM2A
• Common Name: VSTM2A
• Gene Symbol: VSTM2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQSGMETHFEPFILPLTNAPQKGQSYRVDRFMNG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining