Invitrogen™ Human VSIG10 (aa 329-406) Control Fragment Recombinant Protein

Product Code. 30201932

Brand: Invitrogen™ RP108464

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84527 (PA5-84527. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VSIG10 (V-Set And Immunoglobulin Domain Containing 10) is a Protein Coding gene. Diseases associated with VSIG10 include Adenoid Hypertrophy. An important paralog of this gene is CNTN5. [GeneCards]

Specifications

• Accession Number: Q8N0Z9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54621
• Name: Human VSIG10 (aa 329-406) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: RGD1565800; V-set and immunoglobulin domain containing 10; V-set and immunoglobulin domain-containing protein 10; Vsig10
• Common Name: VSIG10
• Gene Symbol: VSIG10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining