Invitrogen™ Human VPS8 (aa 771-843) Control Fragment Recombinant Protein

Code produit. 30196143

Marque: Invitrogen™ RP96382

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57855 (PA5-57855. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in vesicle-mediated protein trafficking of the endocytic membrane transport pathway. Believed to act as a component of the putative CORVET endosomal tethering complexes which is proposed to be involved in the Rab5-to-Rab7 endosome conversion probably implicating MON1A/B, and via binding SNAREs and SNARE complexes to mediate tethering and docking events during SNARE-mediated membrane fusion. The CORVET complex is proposed to function as a Rab5 effector to mediate early endosome fusion probably in specific endosome subpopulations (PubMed:25266290). Functions predominantly in APPL1-containing endosomes (PubMed:25266290). [UniProt]

Spécification

• Accession Number: Q8N3P4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23355
• Name: Human VPS8 (aa 771-843) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI315068; AU040738; im:7166005; KIAA0804; mKIAA0804; RGD1309443; si:dkey-24b15.1; vacuolar protein sorting 8 homolog; vacuolar protein sorting 8 homolog (S. cerevisiae); vacuolar protein sorting-associated protein 8 homolog; VPS8; VPS8 CORVET complex subunit; VPS8 subunit of CORVET complex; VPS8, CORVET complex subunit; zgc:158695
• Common Name: VPS8
• Gene Symbol: VPS8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEIYPYIRTLLHFDTREFLNVLALTFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLARQLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining