Invitrogen™ Human VPS72 (aa 10-77) Control Fragment Recombinant Protein

Product Code. 30203237

Brand: Invitrogen™ RP107449

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66792 (PA5-66792. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vacuolar protein sorting-associated protein 72 homolog (VPS72), also known as VPS72 or Transcription factor-like 1, is a 364 amino acid subunit of the TRRAP/TIP60 HAT complex. VPS72 has also been identified as a subunit of a novel complex containing SNF2-related helicase SRCAP (SWI2/SNF2-related CBP activator protein). This SRCAP-containing complex is very similar to the S. cerevisiae SWR1 chromatin remodeling complex. The involvement of VPS72 in these complexes has suggested that VPS72 plays multiple roles in chromatin modification and remodeling in cells. VPS72 localizes to the nucleus and is phosphorylated upon DNA damage, most likely by ATM or ATR.

Specifications

• Accession Number: Q15906
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6944
• Name: Human VPS72 (aa 10-77) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CFL1; Protein YL-1; Swc2; T YL-1; TCFL1; Transcription factor-like 1; transformation suppressor gene YL-1; vacuolar protein sorting 72 (yeast); vacuolar protein sorting 72 homolog; vacuolar protein sorting 72 homolog (S. cerevisiae); vacuolar protein sorting-associated protein 72 homolog; VPS72; Yl1; YL-1
• Common Name: VPS72
• Gene Symbol: VPS72
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining