Invitrogen™ Human VPS53 (aa 238-344) Control Fragment Recombinant Protein

Product Code. 30212914

Brand: Invitrogen™ RP93279

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54656 (PA5-54656. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The sorting of acid hydrolases to lysosomes rely on mannose 6-phosphate receptors that cycle between the trans-Golgi network (TGN) and endosomes. The maintenance of this cycle requires the function of the mammalian Golgi-associated retrograde protein (GARP) complex which is composed of three subunits: VPS52, VPS53, and VPS54. Depletion of any of these three proteins, such as by RNAi, impairs the retrograde transport of multiple TGN proteins. VPS53 was identified as an HIV dependency factor (HDF) and plays a role in viral entry to the cell, suggesting that VPS53 may be an important drug target in HIV treatment. At least five isoforms of VPS53 are known to exist.

Specifications

• Accession Number: Q5VIR6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55275
• Name: Human VPS53 (aa 238-344) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010002A08Rik; 2310040I21Rik; 3100002B05Rik; Are1; Hccs1; hVps53L; PCH2E; pp13624; RGD1311391; SAC2 suppressor of actin mutations 2-like protein; Sacm2l; vacuolar protein sorting 52 homolog (S. cerevisiae); vacuolar protein sorting 53 (yeast); vacuolar protein sorting 53 homolog (S. cerevisiae); vacuolar protein sorting-associated protein 52 homolog; Vacuolar protein sorting-associated protein 53 homolog; Vps52; Vps53; VPS53 GARP complex subunit; VPS53, GARP complex subunit
• Common Name: VPS53
• Gene Symbol: Vps53
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining