missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human VPS53 (aa 238-344) Control Fragment Recombinant Protein

Product Code. 30212914
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212914

Brand: Invitrogen™ RP93279

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54656 (PA5-54656. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The sorting of acid hydrolases to lysosomes rely on mannose 6-phosphate receptors that cycle between the trans-Golgi network (TGN) and endosomes. The maintenance of this cycle requires the function of the mammalian Golgi-associated retrograde protein (GARP) complex which is composed of three subunits: VPS52, VPS53, and VPS54. Depletion of any of these three proteins, such as by RNAi, impairs the retrograde transport of multiple TGN proteins. VPS53 was identified as an HIV dependency factor (HDF) and plays a role in viral entry to the cell, suggesting that VPS53 may be an important drug target in HIV treatment. At least five isoforms of VPS53 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5VIR6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55275
Name Human VPS53 (aa 238-344) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010002A08Rik; 2310040I21Rik; 3100002B05Rik; Are1; Hccs1; hVps53L; PCH2E; pp13624; RGD1311391; SAC2 suppressor of actin mutations 2-like protein; Sacm2l; vacuolar protein sorting 52 homolog (S. cerevisiae); vacuolar protein sorting 53 (yeast); vacuolar protein sorting 53 homolog (S. cerevisiae); vacuolar protein sorting-associated protein 52 homolog; Vacuolar protein sorting-associated protein 53 homolog; Vps52; Vps53; VPS53 GARP complex subunit; VPS53, GARP complex subunit
Common Name VPS53
Gene Symbol Vps53
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.