missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human VPS41 (aa 455-571) Control Fragment Recombinant Protein

Product Code. 30211652
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211652

Brand: Invitrogen™ RP92600

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54176 (PA5-54176. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human ortholog of yeast Vps41 protein which is also conserved in Drosophila, tomato, and Arabidopsis. Expression studies in yeast and human indicate that this protein may be involved in the formation and fusion of transport vesicles from the Golgi. Several transcript variants encoding different isoforms have been described for this gene, however, the full-length nature of not all is known.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49754
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27072
Name Human VPS41 (aa 455-571) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI317346; fa01f11; HVPS41; hVps41p; HVSP41; mVam2; RGD1560511; S53; si:ch211-146l10.2; vacuolar assembly protein 41; vacuolar protein sorting 41 (yeast); vacuolar protein sorting 41 homolog; vacuolar protein sorting 41 homolog (S. cerevisiae); vacuolar protein sorting-associated protein 41 homolog; Vam2; VAM2 homolog; VPS41; VPS41 HOPS complex subunit; VPS41 subunit of HOPS complex; VPS41, HOPS complex subunit; wu:fa01f11
Common Name VPS41
Gene Symbol VPS41
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLKPLIYEMILHEFLESDYEGFATLIREWPGDLYNNSVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLIHKHNLFSSIKDKIVLLMDFDSEKAVDML
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.