Invitrogen™ Human VPS41 (aa 455-571) Control Fragment Recombinant Protein

Product Code. 30211652

Brand: Invitrogen™ RP92600

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54176 (PA5-54176. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human ortholog of yeast Vps41 protein which is also conserved in Drosophila, tomato, and Arabidopsis. Expression studies in yeast and human indicate that this protein may be involved in the formation and fusion of transport vesicles from the Golgi. Several transcript variants encoding different isoforms have been described for this gene, however, the full-length nature of not all is known.

Specifications

• Accession Number: P49754
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27072
• Name: Human VPS41 (aa 455-571) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI317346; fa01f11; HVPS41; hVps41p; HVSP41; mVam2; RGD1560511; S53; si:ch211-146l10.2; vacuolar assembly protein 41; vacuolar protein sorting 41 (yeast); vacuolar protein sorting 41 homolog; vacuolar protein sorting 41 homolog (S. cerevisiae); vacuolar protein sorting-associated protein 41 homolog; Vam2; VAM2 homolog; VPS41; VPS41 HOPS complex subunit; VPS41 subunit of HOPS complex; VPS41, HOPS complex subunit; wu:fa01f11
• Common Name: VPS41
• Gene Symbol: VPS41
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLKPLIYEMILHEFLESDYEGFATLIREWPGDLYNNSVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLIHKHNLFSSIKDKIVLLMDFDSEKAVDML
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining