Invitrogen™ Human VPS37C (aa 110-169) Control Fragment Recombinant Protein

Product Code. 30203754

Brand: Invitrogen™ RP97446

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60335 (PA5-60335. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VPS37C is a subunit of ESCRT-I pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies.

Specifications

• Accession Number: A5D8V6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55048
• Name: Human VPS37C (aa 110-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ESCRT-I complex subunit VPS37C; FLJ20847; hVps37C; PML39; vacuolar protein sorting 37 homolog C; vacuolar protein sorting 37 C; vacuolar protein sorting-associated protein 37 C; VPS37C; VPS37C, ESCRT-I subunit
• Common Name: VPS37C
• Gene Symbol: VPS37C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KIEEESEAMAEKFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining