Invitrogen™ Human VPS37B (aa 5-103) Control Fragment Recombinant Protein

Product Code. 30197982

Brand: Invitrogen™ RP102818

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58300 (PA5-58300. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation.

Specifications

• Accession Number: Q9H9H4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79720
• Name: Human VPS37B (aa 5-103) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2300007F24Rik; AI415429; BC026744; ESCRT-I complex subunit VPS37B; hVps37B; RGD1304576; vacuolar protein sorting 37 homolog B; vacuolar protein sorting 37 homolog B (S. cerevisiae); vacuolar protein sorting 37 B; vacuolar protein sorting 37 B (yeast); vacuolar protein sorting-associated protein 37 B; Vps37b; VPS37B, ESCRT-I subunit
• Common Name: VPS37B
• Gene Symbol: VPS37B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining