Invitrogen™ Human VPS26B (aa 282-336) Control Fragment Recombinant Protein

Product Code. 30199890

Brand: Invitrogen™ RP97414

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58282 (PA5-58282. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In mammals, there are two paralogues of yeast Vps26, VPS26A and VPS26B. VPS26 is a component of the retromer complex composed of VPS26 (VPS26A or VPS26B), VPS29, VPS35, SNX1 and SNX2. VPS26A and VPS26B subunits define distinct retromer complexes. The retromer complex is important in recycling transmembrane receptors from endosomes to the trans-Golgi network (TGN).

Specifications

• Accession Number: Q4G0F5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 112936
• Name: Human VPS26B (aa 282-336) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810012I05Rik; 2310075A12Rik; AI848392; Pep8b; vacuolar protein sorting 26 homolog B (S. pombe); vacuolar protein sorting 26 homolog B (yeast); vacuolar protein sorting-associated protein 26 B; Vesicle protein sorting 26 B; VPS26 retromer complex component B; VPS26, retromer complex component B; Vps26b
• Common Name: VPS26B
• Gene Symbol: VPS26B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining