Invitrogen™ Human VPARP (aa 247-392) Control Fragment Recombinant Protein

Product Code. 30201023

missing translation for 'mfr': Invitrogen™ RP88733

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82435 (PA5-82435. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes poly(ADP-ribosyl)transferase-like 1 protein, which is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. Since this protein is not capable of binding DNA directly, its transferase activity may be activated by other factors such as protein-protein interaction mediated by the extensive carboxyl terminus.

Specifications

• Accession Number: Q9UKK3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 143
• Name: Human VPARP (aa 247-392) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 193 kDa vault protein; ADP-ribosyltransferase (NAD+; ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 1; ADP-ribosyltransferase diphtheria toxin-like 4; ADPRTL1; ARTD4; C030027K23Rik; E230037B21Rik; Gm743; H5 proline-rich; I-alpha-I-related; KIAA0177; p193; Parp4; PARP-4; PARPL; PARP-related; PARP-related/IalphaI-related H5/proline-rich; PH5P; poly (ADP-ribose) polymerase family, member 4; poly (ADP-ribose) polymerase)-like 1; poly [ADP-ribose] polymerase 4; poly(ADP-ribose) polymerase family member 4; poly(ADP-ribose) synthetase; poly(ADP-ribosyl)transferase-like 1; Protein mono-ADP-ribosyltransferase PARP4; Vault poly(ADP-ribose) polymerase; vault protein, 193-kDa; VAULT3; von Willebrand factor A domain containing 5 C; VPARP; VWA5C
• Common Name: VPARP
• Gene Symbol: PARP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEGILLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMVNVCETNLSKPNPPSLAKYRALRCKIEHVEQNTEEF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining