Invitrogen™ Human VNN1 (aa 436-513) Control Fragment Recombinant Protein

Product Code. 30212942

Brand: Invitrogen™ RP109732

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144806 (PA5-144806. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hematopoietic precursor cells migrate to the thymus, where they differentiate into mature T lymphocytes. GPI-anchored vanin-1 protein regulates the late adhesion steps of thymus homing of bone marrow precursor cells. Vanin-1 is ubiquitously expressed as a pantetheinase enzyme and catalyzes the hydrolysis of pantetheine for vitamin B5 recycling. The hydrolytic activity of vanin-1 generates the potent antioxidant cysteamine as a metabolite. As a membrane bound pantetheinase, vanin-1 provides the main source of cysteamine under normal physiological conditions. In mice, vanin-1 is expressed specifically in male Sertoli cells of the developing testis, where it aids in cell migration.

Specifications

• Accession Number: O95497
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8876
• Name: Human VNN1 (aa 436-513) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: HDLCQ8; Pantetheinase; pantetheine hydrolase; Tiff66; V-1; vanin 1; Vanin1; vanin-1; vannin 1; vascular non-inflammatory molecule 1; VNN1
• Common Name: VNN1
• Gene Symbol: VNN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQARIIMLIVIAPIVCSLSW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining