missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human VN1R2 (aa 231-267) Control Fragment Recombinant Protein

Product Code. 30199384
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199384

Brand: Invitrogen™ RP95169

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60744 (PA5-60744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative pheromone receptor. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NFZ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 317701
Name Human VN1R2 (aa 231-267) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias G-protein coupled receptor GPCR25; hGPCR25; pheromone receptor; V1RL2; V1R-like 2; V1r-like receptor 2; VN1R2; vomeronasal 1 receptor 2; vomeronasal type-1 receptor 2
Common Name VN1R2
Gene Symbol VN1R2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TTGKWSNNNITKKGDLGYCSAPLSDEVTKSVYAALTS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado