Invitrogen™ Human VN1R2 (aa 231-267) Control Fragment Recombinant Protein

Product Code. 30199384

Brand: Invitrogen™ RP95169

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60744 (PA5-60744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative pheromone receptor. [UniProt]

Specifications

• Accession Number: Q8NFZ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 317701
• Name: Human VN1R2 (aa 231-267) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G-protein coupled receptor GPCR25; hGPCR25; pheromone receptor; V1RL2; V1R-like 2; V1r-like receptor 2; VN1R2; vomeronasal 1 receptor 2; vomeronasal type-1 receptor 2
• Common Name: VN1R2
• Gene Symbol: VN1R2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TTGKWSNNNITKKGDLGYCSAPLSDEVTKSVYAALTS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining