Invitrogen™ Human VMO1 (aa 25-112) Control Fragment Recombinant Protein

Product Code. 30211120

Brand: Invitrogen™ RP93495

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54673 (PA5-54673. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VMO1 (Vitelline Membrane Outer Layer 1 Homolog) is a Protein Coding gene.

Specifications

• Accession Number: Q7Z5L0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284013
• Name: Human VMO1 (aa 25-112) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ERGA6350; ERGA6350 antibody; Gm741; MGC125880 antibody; MGC125881 antibody; PRO21055; PRO21055 antibody; RGD1559861; UNQ6350/PRO21055; vitelline membrane outer layer 1 homolog; vitelline membrane outer layer 1 homolog (chicken); vitelline membrane outer layer 1 homolog (chicken) antibody; vitelline membrane outer layer protein 1 homolog; vitelline membrane outer layer protein 1 homolog antibody; VMO1; VMO1 antibody
• Common Name: VMO1
• Gene Symbol: Vmo1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining