Invitrogen™ Human VGLL1 (aa 169-250) Control Fragment Recombinant Protein

Product Code. 30194088

Brand: Invitrogen™ RP107348

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66697 (PA5-66697. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as a specific coactivator for the mammalian TEFs.

Specifications

• Accession Number: Q99990
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51442
• Name: Human VGLL1 (aa 169-250) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Protein TONDU; RGD1564038; TDU; TONDU; Transcription cofactor vestigial-like protein 1; vestigial like 1; vestigial like 1 homolog; vestigial like 1 homolog (Drosophila); vestigial like family member 1; vestigial-like family member 1; vestigial-related factor; VGL1; Vgl-1; VGLL1; WUGSC:H_GS188P18.1 b
• Common Name: VGLL1
• Gene Symbol: VGLL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining