missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human VGLL1 (aa 169-250) Control Fragment Recombinant Protein

Product Code. 30194088
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194088

Brand: Invitrogen™ RP107348

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66697 (PA5-66697. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as a specific coactivator for the mammalian TEFs.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99990
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51442
Name Human VGLL1 (aa 169-250) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Protein TONDU; RGD1564038; TDU; TONDU; Transcription cofactor vestigial-like protein 1; vestigial like 1; vestigial like 1 homolog; vestigial like 1 homolog (Drosophila); vestigial like family member 1; vestigial-like family member 1; vestigial-related factor; VGL1; Vgl-1; VGLL1; WUGSC:H_GS188P18.1 b
Common Name VGLL1
Gene Symbol VGLL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt