Invitrogen™ Human VEZF1 (aa 368-507) Control Fragment Recombinant Protein

Product Code. 30203541

Brand: Invitrogen™ RP100717

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55645 (PA5-55645. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VEZF1 is a possible transcription factor. It specifically binds to the CT/GC-rich region of the interleukin-3 promoter and mediates tax transactivation of IL-3.Transcriptional regulatory proteins containing tandemly repeated zinc finger domains are thought to be involved in both normal and abnormal cellular proliferation and differentiation. ZNF161 is a C2H2-type zinc finger protein. See MIM 603971 for general information on zinc finger proteins.[supplied by OMIM].

Specifications

• Accession Number: Q14119
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7716
• Name: Human VEZF1 (aa 368-507) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI848691; AW046909; DB1; putative transcription factor DB1; Vascular endothelial zinc finger 1; VEZF1; Zinc finger protein 161; ZNF161
• Common Name: VEZF1
• Gene Symbol: VEZF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAAAMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPVTITSPMNLPTPMTLAAPLNIAMRPVES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining