Invitrogen™ Human Versican (aa 35-168) Control Fragment Recombinant Protein

Product Code. 30195887

Brand: Invitrogen™ RP102364

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Versican is a member of the family of large aggregating proteoglycans (also including aggrecan, brevican, and neurocan). The protein shows wide tissue distribution which includes fibrous, articular, and elastic cartilages, as well as nervous, epidermal, arterial, and loose connective tissues. Versican V1 has been shown to enhance cell proliferation, and also induce cell transformation and protect cells from apoptosis. This was demonstrated through its ability to downregulate the expression of proapoptotic Bad. Versican's existence as a extracellular matrix protein in human airways has also lead to the discovery of an inflammatory role in asthmatics.

Specifications

• Accession Number: P13611
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1462
• Name: Human Versican (aa 35-168) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430420N07Rik; 9430051N09; Chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan 2 (versican); chondroitin sulfate proteoglycan core protein 2; Cspg2; DPEAAE; ERVR; GHAP; glial hyaluronate-binding protein; hdf; heart defect; large fibroblast proteoglycan; NG2; PGM; PG-M; PG-M core protein; PG-M(V0); PG-M(V1); V1 Neo; VCAN; versican; versican core protein; Versican core protein precursor (Large fibroblast proteoglycan) (Chondroitin sulfate proteoglycan core protein 2) (PG-M); versican proteoglycan; Versican V0; WGN; WGN 1; WGN1
• Common Name: Versican
• Gene Symbol: VCAN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining