missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human VEGFA (NP_001165097) Recombinant Protein

Product Code. 16181600
Click to view available options
Quantity:
10 μg
Unit Size:
10µg
This item is not returnable. View return policy

Product Code. 16181600

Brand: Abnova™ P4577.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Used for Func, SDS-PAGE

This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. [provided by RefSeq]

Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Specifications

Accession Number NP_001165097
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 7422
Molecular Weight (g/mol) 38.2kDa
Name VEGFA (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Quality Control Testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quantity 10 μg
Immunogen MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Storage Requirements Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1 EU/μg
Gene Alias MGC70609/VEGF/VEGF-A/VPF
Common Name VEGFA
Gene Symbol VEGFA
Biological Activity The activity is determined by the dose dependent proliferation of HUVECs. The expected ED50 for this effect is 3.1-4.6ng/mL.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.