Learn More
Abnova™ Human VEGFA (NP_001165097) Recombinant Protein
Description
This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. [provided by RefSeq]
Specifications
Specifications
| Accession Number | NP_001165097 |
| For Use With (Application) | Functional Study, SDS-PAGE |
| Formulation | Lyophilized |
| Gene ID (Entrez) | 7422 |
| Molecular Weight (g/mol) | 38.2kDa |
| Name | VEGFA (Human) Recombinant Protein |
| Preparation Method | Escherichia coli expression system |
| Quality Control Testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quantity | 10 μg |
| Immunogen | MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.