missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human VEGF Receptor 3 (aa 57-199) Control Fragment Recombinant Protein

Product Code. 30195259
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195259

Brand: Invitrogen™ RP108373

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111235 (PA5-111235. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vascular endothelial growth factor is a key regulator of blood vessel development in embryos and angiogenesis in adult tissues. Unlike VEGF, the related VEGFC stimulates the growth of lymphatic vessels through its specificl ymphatic endothelial receptor VEGFR-3. In 1998, Dumont showed that targeted inactivation of the VEGFR-3 gene in mice resulted in defective blood vessel development in early embryos. Vasculogenesis and angiogenesis occurred, but large vessels became abnormally organized with defective lumens, leading to fluid accumulation in the pericardial cavity and cardiovascular failure at embryonic day 9.5. Thus, VEGFR3 has an essential role in the development of theembryonic cardiovascular system before the emergence of the lymphatic vessels.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P35916
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2324
Name Human VEGF Receptor 3 (aa 57-199) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI323512; Chy; chylous ascites; Flt4; FLT-4; FLT41; fms related tyrosine kinase 4; FMS-like tyrosine kinase 4; fms-related tyrosine kinase 4; LMPH1A; PCL; receptor protein tyrosine kinase; soluble VEGFR 3; sVEGFR 3; tyrosine-protein kinase receptor FLT4; Vascular endothelial growth factor receptor 3; vascular endothelial growth factor receptor-3; VEGF R3; VEGFR3; VEGFR-3
Common Name VEGF Receptor 3
Gene Symbol FLT4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.