Invitrogen™ Human VDP (aa 553-634) Control Fragment Recombinant Protein

Product Code. 30213146

Brand: Invitrogen™ RP104687

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates from the membrane upon phosphorylation. Ras-associated protein 1 recruits this protein to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where it interacts with a set of COPII vesicle-associated SNAREs to form a cis-SNARE complex that promotes targeting to the Golgi apparatus. Transport from the ER to the cis/medial Golgi compartments requires the action of this gene product, GM130 and giantin in a sequential manner.

Specifications

• Accession Number: O60763
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8615
• Name: Human VDP (aa 553-634) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 115 kDa; General vesicular transport factor p115; P115; protein USO1 homolog; TAP; transcytosis associated protein; transcytosis associated protein p115; transcytosis-associated protein; USO1; USO1 homolog, vesicle docking protein; USO1 vesicle docking factor; USO1 vesicle docking protein homolog; USO1 vesicle transport factor; Vdp; VDP p115; vesicle docking protein p115; vesicle docking protein, 115 kDa; vesicle-docking protein
• Common Name: VDP
• Gene Symbol: USO1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DNSLESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining