Invitrogen™ Human VANGL2 (aa 241-352) Control Fragment Recombinant Protein

Product Code. 30198124

Brand: Invitrogen™ RP91169

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55494 (PA5-55494. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Van Gogh is an alternate name for the Drosophila strabismus protein. Van Gogh like-2 (VANGL2) is a 521 amino acidprotein in vertebrates similar to strabismus 1 of Drosophila and a component of the frizzled-disheveled tissue polarity pathway. It interacts through it's C-terminal region with the N-terminal half of DVL1, DVL2 and DVL3 and is a potent tumor suppressor. It ispredominantly involved in the control of early morphogenesis and patterning of both axial midline structures and the development of neural plate. It plays a crucial role in the regulation of planar cell polarity, particularly in the orientation of stereociliary bundles in the cochlea. VANGL2 is required for polarization and movement of myocardializing cells and seems to act via RHOA signaling to regulate this process. It is expressed in a wide range of tissues.

Specifications

• Accession Number: Q9ULK5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57216
• Name: Human VANGL2 (aa 241-352) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C530001F03Rik; KIAA1215; loop tail associated protein; loop-tail; Loop-tail protein 1; loop-tail protein 1 homolog; Loop-tail-associated protein; Lp; LPP1; Ltap; MGC119403; MGC119404; RGD:1309442}; ska17; STB1; stbm; STBM1; strabismus; Strabismus 1; van Gogh-like protein 2; vang; vang (van gogh)-like 2; Vang1l2; VANGL planar cell polarity protein 2; Vangl2; vangl2 {ECO:0000312; vang-like 2 (van gogh, Drosophila); vang-like protein 2
• Common Name: VANGL2
• Gene Symbol: Vangl2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining