Invitrogen™ Human VAC14 (aa 400-540) Control Fragment Recombinant Protein

Product Code. 30206083

Brand: Invitrogen™ RP102033

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55685 (PA5-55685. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vac14 a putative cytoskeletal interacting protein; mutation of gene may be associated with lethal communicating hydrocephalus with perinatal onset.

Specifications

• Accession Number: Q08AM6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55697
• Name: Human VAC14 (aa 400-540) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA959718; ArPIKfyve; BC032215; D8Wsu151e; ingls; Protein VAC14 homolog; Ta x 1 (human T-cell leukemia virus type I) binding protein 1; Ta x 1 (human T-cell leukemia virus type I) binding protein 2; ta x 1-binding protein 2; TA x 1 BP2; TRX; Vac14; Vac14 homolog; Vac14 homolog (S. cerevisiae); Vac14, PIKFYVE complex component; vacuole 14 protein; vacuole morphology 14
• Common Name: VAC14
• Gene Symbol: Vac14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IVQVLNCHLSDTAIGMMTRIAVLKWLYHLYIKTPRKMFRHTDSLFPILLQTLSDESDEVILKDLEVLAEIASSPAGQTDDPGPLDGPDLQASHSELQVPTPGRAGLLNTSGTKGLECSPSTPTMNSYFYKFMINLLKRFSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining