Invitrogen™ Human V-ATPase G3 (aa 36-115) Control Fragment Recombinant Protein

Product Code. 30208023

Brand: Invitrogen™ RP94314

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55953 (PA5-55953. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V1G3 (V-ATPase G3) is a catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Specifications

• Accession Number: Q96LB4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 127124
• Name: Human V-ATPase G3 (aa 36-115) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ATP6G3; ATP6V1G3; ATPase H+ transporting V1 subunit G3; ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G3; ATPase, H+ transporting, lysosomal 13 kDa, V1 subunit G3; ATPase, H+ transporting, lysosomal V1 subunit G3; ATPase, H+ transporting, lysosomal, V1 subunit G3; ATPase, H+ transporting, V1 subunit G, isoform 3; vacuolar ATP synthase subunit G 3; vacuolar proton pump G subunit 3; vacuolar proton pump subunit G 3; vacuolar proton pump, subunit G3; V-ATPase 13 kDa subunit 3; V-ATPase G subunit 3; V-ATPase G3 subunit; V-ATPase subunit G 3; Vma10; V-type proton ATPase subunit G 3
• Common Name: V-ATPase G3
• Gene Symbol: ATP6V1G3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining