Invitrogen™ Human V-ATPase E1 (aa 60-224) Control Fragment Recombinant Protein

Product Code. 30212905

Brand: Invitrogen™ RP91321

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83071 (PA5-83071. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Specifications

• Accession Number: P36543
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 529
• Name: Human V-ATPase E1 (aa 60-224) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410029D23Rik; Atp6e; Atp6e2; ATP6V1E; Atp6v1e1; ATPase H+ transporting V1 subunit E1; ATPase, H+ transporting lysosomal (vacuolar proton pump), 32 kDa; ATPase, H+ transporting, lysosomal 31 kDa, V1 subunit E; ATPase, H+ transporting, lysosomal 31 kDa, V1 subunit E1; ATPase, H+ transporting, lysosomal V1 subunit E1; ATPase, H+ transporting, V1 subunit E; D6Ertd385e; E2; H(+)-ATPase E-like protein; H(+)-transporting two-sector ATPase, 31 kDa subunit; H+ ATPase subunit E; H+-transporting ATP synthase chain E, vacuolar; lysosomal 31 kDa; P31; vacuolar H(+)-ATPase, E subunit; vacuolar H+ ATPase E1; vacuolar proton pump subunit E 1; V-ATPase 31 kDa subunit; V-ATPase subunit E; V-ATPase subunit E 1; VATPase, H+ transporting, lysosomal V1 subunit E1; V-ATPase, subunit E; Vma4; V-type proton ATPase subunit E 1
• Common Name: V-ATPase E1
• Gene Symbol: ATP6V1E1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining