Invitrogen™ Human UTP18 (aa 118-204) Control Fragment Recombinant Protein

Product Code. 30197136

Brand: Invitrogen™ RP93228

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62596 (PA5-62596. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UTP18 is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.

Specifications

• Accession Number: Q9Y5J1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51096
• Name: Human UTP18 (aa 118-204) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6230425C22Rik; 6430513M13; CDABP0061; CGI-48; U3 small nucleolar RNA-associated protein 18 homolog; Utp18; UTP18 small subunit (SSU) processome component homolog; UTP18 small subunit processome component; UTP18, small subunit (SSU) processome component, homolog; UTP18, small subunit (SSU) processome component, homolog (yeast); UTP18, small subunit processome component; WD repeat domain 50; WD repeat-containing protein 50; Wdr50
• Common Name: UTP18
• Gene Symbol: UTP18
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining