Invitrogen™ Human UTP14C (aa 288-345) Control Fragment Recombinant Protein

Product Code. 30182532

Brand: Invitrogen™ RP99596

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61468 (PA5-61468. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q5TAP6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9724
• Name: Human UTP14C (aa 288-345) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700066J21Rik; KIAA0266; U3 small nucleolar RNA-associated protein 14 homolog C; UTP14, small subunit processome component homolog C (S. cerevisiae); UTP14, U3 small nucleolar ribonucleoprotein, homolog C; UTP14B; UTP14C
• Common Name: UTP14C
• Gene Symbol: UTP14C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAKNKELTQKLQVASESEEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining