Invitrogen™ Human UTP11L (aa 80-161) Control Fragment Recombinant Protein

Product Code. 30208458

Brand: Invitrogen™ RP94494

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61100 (PA5-61100. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in nucleolar processing of pre-18S ribosomal RNA. Target protein may have a role in maintainance of neuronal function.

Specifications

• Accession Number: Q9Y3A2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51118
• Name: Human UTP11L (aa 80-161) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700082D03Rik; Cgi94; CGI-94; HDCMB12P; Probable U3 small nucleolar RNA-associated protein 11; RGD1559610; U3 snoRNA-associated protein 11; UTP11; UTP11, small subunit processome component homolog (S. cerevisiae); UTP11L; UTP11-like protein; UTP11-like, U3 small nucleolar ribonucleoprotein; UTP11-like, U3 small nucleolar ribonucleoprotein, (yeast)
• Common Name: UTP11L
• Gene Symbol: UTP11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining