Invitrogen™ Human USP47 (aa 616-709) Control Fragment Recombinant Protein

Product Code. 30197453

Brand: Invitrogen™ RP95859

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56102 (PA5-56102. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitin-specific protease that specifically deubiquitinates monoubiquitinated DNA polymerase beta (POLB), stabilizing POLB thereby playing a role in base-excision repair (BER). Acts as a regulator of cell growth and genome integrity. May also indirectly regulate CDC25A expression at a transcriptional level. [UniProt]

Specifications

• Accession Number: Q96K76
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55031
• Name: Human USP47 (aa 616-709) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930502N04Rik; A630020C16Rik; deubiquitinating enzyme 47; Trf (TATA binding protein-related factor)-proximal homolog; TRFP; Ubiquitin carboxyl-terminal hydrolase 47; ubiquitin specific peptidase 47; ubiquitin specific protease 47; ubiquitin thioesterase 47; ubiquitin thiolesterase 47; ubiquitin-specific-processing protease 47; Usp47
• Common Name: USP47
• Gene Symbol: USP47
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining