Invitrogen™ Human USP43 (aa 341-475) Control Fragment Recombinant Protein

Product Code. 30212467

Brand: Invitrogen™ RP110170

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144738 (PA5-144738. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [UniProt]

Specifications

• Accession Number: Q70EL4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 124739
• Name: Human USP43 (aa 341-475) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Deubiquitinating enzyme 43; ubiquitin carboxyl-terminal hydrolase 43; ubiquitin specific peptidase 43; ubiquitin specific protease 43; ubiquitin thioesterase 43; ubiquitin thiolesterase 43; ubiquitin-specific-processing protease 43; USP43
• Common Name: USP43
• Gene Symbol: USP43
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEDLNTIAEGDNVYAFQVPPSPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFLIREDRAVSWAQLQQSILSKVRHLMKSEAPVQNLGSLFSIRVVGLSVACSYLSPKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining