Invitrogen™ Human USP42 (aa 454-580) Control Fragment Recombinant Protein

Product Code. 30199478

Brand: Invitrogen™ RP89246

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52338 (PA5-52338. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

USP42 (ubiquitin specific peptidase 42) is a 1,325 amino acid protein that belongs to the peptidase C19 family. Expressed in a variety of tissues, USP42 functions to catalyze the conversion of a ubiquitin C-terminal thioester to a free ubiquitin and a thiol. The gene encoding USP42 maps to human chromosome 7, which houses over 1,000 genes and comprises nearly 5% of the human genome. Defects in some of the genes localized to chromosome 7 have been linked to Osteogenesis imperfecta, Williams-Beuren syndrome, Pendred syndrome, Lissencephaly, Citrullinemia and Shwachman-Diamond syndrome.

Specifications

• Accession Number: Q9H9J4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84132
• Name: Human USP42 (aa 454-580) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410140K03Rik; 3110031A07Rik; A630018G05Rik; D5Ertd591e; Deubiquitinating enzyme 42; ubiquitin carboxyl-terminal hydrolase 42; ubiquitin specific peptidase 42; ubiquitin specific protease 42; ubiquitin thioesterase 42; ubiquitin thiolesterase 42; ubiquitin-specific-processing protease 42; Usp42
• Common Name: USP42
• Gene Symbol: Usp42
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PQLPSHMIKNPPHLNGTGPLKDTPSSSMSSPNGNSSVNRASPVNASASVQNWSVNRSSVIPEHPKKQKITISIHNKLPVRQCQSQPNLHSNSLENPTKPVPSSTITNSAVQSTSNASTMSVSSKVTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining