Invitrogen™ Human USP39 (aa 469-561) Control Fragment Recombinant Protein

Codice prodotto. 30196722

Marca: Invitrogen™ RP96191

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140204 (PA5-140204. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

USP39 may play a role in mRNA splicing. It is unsure if the protein really exhibits hydrolase activity. It could be a competitor of ubiquitin C-terminal hydrolases.

Specifica

• Accession Number: Q53GS9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10713
• Name: Human USP39 (aa 469-561) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 65 K; AA408960; AI894154; CGI-21; D6Wsu157e; HSPC332; Inactive ubiquitin-specific peptidase 39; PRO2855; SAD1; SAD1 homolog; small nuclear ribonucleoprotein 65 kDa (U4/U6.U5); SnRNP assembly defective 1 homolog; SNRNP65; U4/U6.U5 tri-snRNP-associated 65 kDa protein; U4/U6.U5 tri-snRNP-associated protein 2; ubiquitin specific peptidase 39; ubiquitin specific protease 39; Usp39
• Common Name: USP39
• Gene Symbol: USP39
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining