missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196722

Invitrogen™ Human USP39 (aa 469-561) Control Fragment Recombinant Protein

Product Code. 30196722
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30196722

missing translation for 'mfr': Invitrogen™ RP96191

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140204 (PA5-140204. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

USP39 may play a role in mRNA splicing. It is unsure if the protein really exhibits hydrolase activity. It could be a competitor of ubiquitin C-terminal hydrolases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q53GS9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10713
Name Human USP39 (aa 469-561) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 65 K; AA408960; AI894154; CGI-21; D6Wsu157e; HSPC332; Inactive ubiquitin-specific peptidase 39; PRO2855; SAD1; SAD1 homolog; small nuclear ribonucleoprotein 65 kDa (U4/U6.U5); SnRNP assembly defective 1 homolog; SNRNP65; U4/U6.U5 tri-snRNP-associated 65 kDa protein; U4/U6.U5 tri-snRNP-associated protein 2; ubiquitin specific peptidase 39; ubiquitin specific protease 39; Usp39
Common Name USP39
Gene Symbol USP39
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.