Invitrogen™ Human USP35 (aa 960-1018) Control Fragment Recombinant Protein

Product Code. 30193902

Brand: Invitrogen™ RP101227

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63591 (PA5-63591. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

p73 protein is a member of the p53 family of proteins. The tumor-suppressor protein p53 exhibits sequence specific DNA-binding, directly interacts with various cellular and viral proteins, and induces cell cycle arrest in response to DNA damage. In response to signals generated by a variety of genotoxic stresses, e.g, UV irradiation or DNA damage, p53 is expressed and undergoes post-translational modification that results in its accumulation in the nucleus. Activation of p53 leads to cell cycle arrest and in some cases to apoptosis, resulting in the inability of genetically damaged cells to proliferate. Thus, the p53-dependent pathways help to maintain genomic stability by eliminating damaged cells. The accumulation of high levels of p53 is a potential marker for malignancy.

Specifications

• Accession Number: Q9P2H5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57558
• Name: Human USP35 (aa 960-1018) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Deubiquitinating enzyme 35; Gm1088; Gm493; KIAA1372; LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 35; RGD1565984; Ubiquitin carboxyl-terminal hydrolase 35; ubiquitin specific peptidase 35; ubiquitin specific protease 35; ubiquitin thioesterase 35; ubiquitin thiolesterase 35; ubiquitin-specific-processing protease 35; USP34; USP35
• Common Name: USP35
• Gene Symbol: USP35
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining