missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211370

Invitrogen™ Human USP33 (aa 86-204) Control Fragment Recombinant Protein

Product Code. 30211370
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211370

Brand: Invitrogen™ RP89231

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52191 (PA5-52191. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-directed RNA polymerase I subunit RPA43 or Twist neighbor protein (Twistnb)belongs to the eukaryotic RPA43 RNA polymerase subunit family. It catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.Twistnb is the component of RNA polymerase I which synthesizes ribosomal RNA precursors. It is widely expressed in all fetal and adult tissues, with highest expression in fetal lung, liver, and kidney, and low expression in all adult tissues. Twist genes are essential for embryonic development and are conserved from jellyfish to human.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TEY7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23032
Name Human USP33 (aa 86-204) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9830169D19Rik; AA409780; Deubiquitinating enzyme 33; hVDU1; KIAA1097; pVHL-interacting deubiquitinating enzyme 1; ubiquitin carboxyl-terminal hydrolase 33; ubiquitin specific peptidase 33; ubiquitin specific protease 33; ubiquitin thioesterase 33; ubiquitin thiolesterase 33; ubiquitin-specific-processing protease 33; Usp33; VDU1; Vhlh-interacting deubiquitinating enzyme 1; VHL-interacting deubiquitinating enzyme 1
Common Name USP33
Gene Symbol USP33
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.