Invitrogen™ Human USP29 (aa 727-817) Control Fragment Recombinant Protein

Artikelnummer. 30206957

Marke: Invitrogen™ RP109559

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140285 (PA5-140285. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

USP29 (Ubiquitin Specific Peptidase 29) is a Protein Coding gene. Among its related pathways are Ubiquitin-Proteasome Dependent Proteolysis. Gene Ontology (GO) annotations related to this gene include cysteine-type endopeptidase activity and thiol-dependent ubiquitin-specific protease activity. An important paralog of this gene is USP37. [GeneCards]

Spezifikation

• Accession Number: Q9HBJ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57663
• Name: Human USP29 (aa 727-817) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ASL1/Usp29 fusion; deubiquitinating enzyme 29; HOM-TES-84/86; Ocat; ossification center-associated transcript; ubiquitin carboxyl-terminal hydrolase 29; ubiquitin specific peptidase 29; ubiquitin specific protease 29; ubiquitin thioesterase 29; ubiquitin thiolesterase 29; ubiquitin-specific processing protease; ubiquitin-specific-processing protease 29; Usp29
• Common Name: USP29
• Gene Symbol: USP29
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQKADLNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining