Invitrogen™ Human USP26 (aa 692-775) Control Fragment Recombinant Protein

Product Code. 30204540

Brand: Invitrogen™ RP110233

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145201 (PA5-145201. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases and is a deubiquitinating enzyme (DUB) with His and Cys domains. It is specifically expressed in testis tissue. Mutations in this gene have been associated with Sertoli cell-only syndrome and male infertility.

Specifications

• Accession Number: Q9BXU7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83844
• Name: Human USP26 (aa 692-775) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Deubiquitinating enzyme 26; RGD1563443; Ubiquitin carboxyl-terminal hydrolase 26; ubiquitin specific peptidase 26; ubiquitin specific protease 26; ubiquitin thioesterase 26; ubiquitin thiolesterase 26; ubiquitin-specific processing protease 26; ubiquitin-specific-processing protease 26; USP26
• Common Name: USP26
• Gene Symbol: USP26
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining