Invitrogen™ Human USP24 (aa 1390-1487) Control Fragment Recombinant Protein

Product Code. 30201120

Brand: Invitrogen™ RP94383

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55394 (PA5-55394. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP24 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes.

Specifications

• Accession Number: Q9UPU5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23358
• Name: Human USP24 (aa 1390-1487) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700066K03Rik; 2810030C21Rik; AI414051; B130021E18; C79851; deubiquitinating enzyme 24; KIAA1057; Ubiquitin carboxyl-terminal hydrolase 24; ubiquitin specific peptidase 24; ubiquitin specific protease 24; ubiquitin thioesterase 24; ubiquitin thiolesterase 24; ubiquitin-specific processing protease 24; ubiquitin-specific-processing protease 24; Usp24
• Common Name: USP24
• Gene Symbol: USP24
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGICVRQQSVSTKDSLIAGEALSLLVTCLQLRSQQLASFYNLPCVADFIIDILLGSPSAEIRRVACDQLYTLSQTDTSAHPDVQKPNQFLLGVILTAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining