missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human USP16 (aa 104-229) Control Fragment Recombinant Protein

Product Code. 30201189
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201189

Brand: Invitrogen™ RP91815

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82746 (PA5-82746. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Modification of target proteins by ubiquitin participates in a wide array of biological functions. Proteins destined for degradation or processing via the 26 S proteasome are coupled to multiple copies of ubiquitin. However, attachment of ubiquitin or ubiquitin-related molecules may also result in changes in subcellular distribution or modification of protein activity. An additional level of ubiquitin regulation, deubiquitination, is catalyzed by proteases called deubiquitinating enzymes, which fall into four distinct families. Ubiquitin C-terminal hydrolases, ubiquitin-specific processing proteases (USPs),1 OTU-domain ubiquitin-aldehyde-binding proteins, and Jab1/Pad1/MPN-domain-containing metallo-enzymes. Among these four families, USPs represent the most widespread and represented deubiquitinating enzymes across evolution. USPs tend to release ubiquitin from a conjugated protein. They display similar catalytic domains containing conserved Cys and His boxes but divergent N-terminal and occasionally C-terminal extensions, which are thought to function in substrate recognition, subcellular localization, and protein-protein interactions.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y5T5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10600
Name Human USP16 (aa 104-229) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200004E02Rik; 2810483I07Rik; 6330514E22Rik; Deubiquitinating enzyme 16; deubiquitinating enzyme 16 {ECO:0000255; HAMAP-Rule:MF_03062}; MSTP039; Ubiquitin carboxyl-terminal hydrolase 16; ubiquitin carboxyl-terminal hydrolase 16 {ECO:0000255; Ubiquitin carboxyl-terminal hydrolase 16-like protein; ubiquitin specific peptidase 16; ubiquitin specific protease 16; ubiquitin thioesterase 16; ubiquitin thioesterase 16 {ECO:0000255; ubiquitin thiolesterase 16; ubiquitin-processing protease UBP-M; ubiquitin-specific processing protease 16; ubiquitin-specific-processing protease 16; ubiquitin-specific-processing protease 16 {ECO:0000255; UBPM; UBP-M; USP16
Common Name USP16
Gene Symbol USP16
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKQASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.