missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211003

Invitrogen™ Human USP11 (aa 89-216) Control Fragment Recombinant Protein

Product Code. 30211003
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211003

Brand: Invitrogen™ RP92187

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82061 (PA5-82061. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

USP11 (ubiquitin specific peptidase 11), also known as UHX1, is a 920 amino acid deubiquitinating enzyme that participates in the Ub pathway. Localized to the nucleus, USP11 associates with both Ran BP-M (Ran binding protein M) and with the tumor suppressor BRCA2. Through these associations, USP11 functions to either inhibit ubiquitination of these proteins or to remove ubiquitin residues that have already been attached to these proteins. USP11 is implicated in several X-linked retinal diseases and, due to its ability to deubiquitinate BRCA2, may play a role in tumor suppression.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P51784
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8237
Name Human USP11 (aa 89-216) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6230415D12Rik; deubiquitinating enzyme 11; mKIAA4085; RP4-659F15.2; Ubiquitin carboxyl-terminal hydrolase 11; ubiquitin carboxyl-terminal hydrolase, X-linked; ubiquitin specific peptidase 11; ubiquitin specific protease 11; ubiquitin thioesterase 11; ubiquitin thiolesterase 11; ubiquitin-specific processing protease 11; ubiquitin-specific-processing protease 11; UHX1; USP11
Common Name USP11
Gene Symbol USP11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.