missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197956

Invitrogen™ Human USP10 (aa 276-386) Control Fragment Recombinant Protein

Product Code. 30197956
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197956

Brand: Invitrogen™ RP89243

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52337 (PA5-52337. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

USP10, also known as ubiquitin specific peptidase 10, belongs to the ubiquitin-specific protease family of cysteine proteases. USP10 functions to catalyze the cleavage of ubiquitin from ubiquitin-conjugated protein substrates such as p53/TP53, SNX3 and CFTR. USP10 has been identified as a subunit of DNA-bound androgen receptor (AR) complexes and may play a role in the activity of the DNA-bound androgen receptor complex. USP10 also acts as an essential regulator of p53/TP53 stability and is thought to function as a tumor suppressor.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14694
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9100
Name Human USP10 (aa 276-386) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610014N07Rik; Deubiquitinating enzyme 10; KIAA0190; MGC2621; mKIAA0190; Ode-1; ubiquintin c-terminal hydrolase related polypeptide; ubiquitin carboxyl-terminal hydrolase 10; ubiquitin specific peptidase 10; ubiquitin specific protease 10; ubiquitin thioesterase 10; ubiquitin thiolesterase 10; ubiquitin-specific-processing protease 10; UBPO; Uchrp; USP10
Common Name USP10
Gene Symbol Usp10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TDTTENLGVANGQILESSGEGTATNGVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSKPSSSSPVAYVETKYSPPAISPLVSEKQVEVKEGLVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.