Invitrogen™ Human USH1C (aa 363-442) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30210036	100 μL	100µL

Product Code. 30210036 Supplier Invitrogen™ Supplier No. RP95088

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82975 (PA5-82975. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a scaffold protein that functions in the assembly of Usher protein complexes. The protein contains PDZ domains, a coiled-coil region with a bipartite nuclear localization signal and a PEST degradation sequence. Defects in this gene are the cause of Usher syndrome type 1C and non-syndromic sensorineural deafness autosomal recessive type 18. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9Y6N9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10083
• Name: Human USH1C (aa 363-442) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010016F01Rik; AIE75; AIE-75; Antigen NY-CO-38/NY-CO-37; autoimmune enteropathy-related antigen AIE-75; DFNB18; DFNB18A; harmonin; harmonin a1; harmonin pseudogene; hypothetical protein LOC530709; hypothetical protein LOC564412; NY-CO-37; NY-CO-38; PDZ domain-containing protein; PDZ-45; PDZ73; PDZ-73; PDZ-73 protein; PDZ-73/NY-CO-38; PDZD7C; Protein PDZ-73; Renal carcinoma antigen NY-REN-3; USH1 protein network component harmonin; Ush1c; ush1cpst; Usher syndrome 1 C; Usher syndrome 1 C (autosomal recessive, severe); Usher syndrome 1 C homolog; usher syndrome type-1 C protein; Usher syndrome type-1 C protein homolog; zgc:136806
• Common Name: USH1C
• Gene Symbol: USH1C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining