missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human USH1C (aa 363-442) Control Fragment Recombinant Protein

Product Code. 30210036
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30210036 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30210036 Supplier Invitrogen™ Supplier No. RP95088

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82975 (PA5-82975. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a scaffold protein that functions in the assembly of Usher protein complexes. The protein contains PDZ domains, a coiled-coil region with a bipartite nuclear localization signal and a PEST degradation sequence. Defects in this gene are the cause of Usher syndrome type 1C and non-syndromic sensorineural deafness autosomal recessive type 18. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6N9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10083
Name Human USH1C (aa 363-442) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010016F01Rik; AIE75; AIE-75; Antigen NY-CO-38/NY-CO-37; autoimmune enteropathy-related antigen AIE-75; DFNB18; DFNB18A; harmonin; harmonin a1; harmonin pseudogene; hypothetical protein LOC530709; hypothetical protein LOC564412; NY-CO-37; NY-CO-38; PDZ domain-containing protein; PDZ-45; PDZ73; PDZ-73; PDZ-73 protein; PDZ-73/NY-CO-38; PDZD7C; Protein PDZ-73; Renal carcinoma antigen NY-REN-3; USH1 protein network component harmonin; Ush1c; ush1cpst; Usher syndrome 1 C; Usher syndrome 1 C (autosomal recessive, severe); Usher syndrome 1 C homolog; usher syndrome type-1 C protein; Usher syndrome type-1 C protein homolog; zgc:136806
Common Name USH1C
Gene Symbol USH1C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.