Invitrogen™ Human UQCRB (aa 51-111) Control Fragment Recombinant Protein

Product Code. 30208691

Brand: Invitrogen™ RP100175

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60223 (PA5-60223. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UQCRB encodes a product that is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping.

Specifications

• Accession Number: P14927
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7381
• Name: Human UQCRB (aa 51-111) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210415M14Rik; Complex III subunit 7; complex III subunit VII; Cytochrome b-c1 complex subunit 7; MC3DN3; mitochondrial ubiquinone-binding protein; QCR7; QPC; QP-C; ubiquinol-cytochrome c reductase binding protein; ubiquinol-cytochrome c reductase binding protein-like; ubiquinol-cytochrome c reductase complex 14 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit VI; UQBC; UQBP; UQCR6; Uqcrb; Uqcrbl; UQPC
• Common Name: UQCRB
• Gene Symbol: UQCRB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining