Invitrogen™ Human UPK1B (aa 116-168) Control Fragment Recombinant Protein

Product Code. 30207401

Brand: Invitrogen™ RP95613

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56863 (PA5-56863. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions.

Specifications

• Accession Number: O75841
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7348
• Name: Human UPK1B (aa 116-168) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI413235; tetraspan; tetraspanin-20; Tspan20; Tspan-20; UP1b; UPIb; Upk1; Upk1b; uroplakin 1 B; uroplakin Ib; Uroplakin-1 b
• Common Name: UPK1B
• Gene Symbol: UPK1B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining