Invitrogen™ Human UPF2 (aa 1174-1269) Control Fragment Recombinant Protein

Product Code. 30210489

Brand: Invitrogen™ RP107535

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66888 (PA5-66888. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located in the perinuclear area. It interacts with translation release factors and the proteins that are functional homologs of yeast Upf1p and Upf3p. Two splice variants have been found for this gene; both variants encode the same protein.

Specifications

• Accession Number: Q9HAU5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26019
• Name: Human UPF2 (aa 1174-1269) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: HUPF2; KIAA1408; Nonsense mRNA reducing factor 2; regulator of nonsense transcripts 2; RENT2; smg-3; smg-3 homolog, nonsense mediated mRNA decay factor; UPF2; UPF2 regulator of nonsense transcripts homolog (yeast); up-frameshift suppressor 2 homolog; yeast Upf2p homolog
• Common Name: UPF2
• Gene Symbol: UPF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining