missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181962

Invitrogen™ Human UNC45A (aa 876-943) Control Fragment Recombinant Protein

Product Code. 30181962
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181962

Brand: Invitrogen™ RP98108

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58703 (PA5-58703. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UNC45A, also named as SMAP1, acts as co-chaperone for HSP90. UNC45A prevents the stimulation of HSP90AB1 ATPase activity by AHSA1. It is a positive factor in promoting PGR function in the cell. It is necessary for proper folding of myosin and necessary for normal cell proliferation, normal myotube formation and myosin accumulation during muscle cell development. UNC45A plays a role in erythropoiesis in stroma cells in the spleen.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H3U1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55898
Name Human UNC45A (aa 876-943) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW538196; GCUNC45; GC-UNC45; GCUNC-45; general cell UNC45; IRO039700; Protein unc-45 homolog A; RGD1305357; SMAP1; SMAP-1; smooth muscle cell associated protein-1; smooth muscle cell-associated protein 1; Stromal membrane-associated protein 1; unc-45 homolog A; unc-45 homolog A (C. elegans); unc-45 myosin chaperone A; Unc45a; UNC-45 A
Common Name UNC45A
Gene Symbol UNC45A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.